General Information

  • ID:  hor000917
  • Uniprot ID:  NA
  • Protein name:  Gastrin
  • Gene name:  NA
  • Organism:  Pseudis bolbodactyla
  • Family:  Gastrin/cholecystokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  NA
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  DLLASLTHEQKQLIMSQLLPELLSELSNAEDHLHPMRDRDYAGWMDF
  • Length:  47
  • Propeptide:  NA
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000917_AF2.pdbhor000917_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 632994 Formula: C242H377N65O76S3
Absent amino acids: CV Common amino acids: L
pI: 4.32 Basic residues: 6
Polar residues: 8 Hydrophobic residues: 16
Hydrophobicity: -45.32 Boman Index: -8693
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 97.66
Instability Index: 5403.4 Extinction Coefficient cystines: 6990
Absorbance 280nm: 151.96

Literature

  • PubMed ID:  1633800
  • Title:  Identification of Cholecystokinin/Gastrin Peptides in Frog and Turtle. Evidence That Cholecystokinin Is Phylogenetically Older Than Gastrin